Loading...
Statistics
Advertisement

Meine Homepage
www.patricksauerland.de/

Patricksauerland.de

Advertisement
Conversion Technology Metas Server
Patricksauerland.de is hosted in Germany . Patricksauerland.de doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Swf Object, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Patricksauerland.de

Technology

Number of occurences: 3
  • CSS
  • Html
  • Swf Object

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Patricksauerland.de

Missing HTTPS protocol.

    Meta - Patricksauerland.de

    Number of occurences: 3
    • Name:
      Content: text/css
    • Name: generator
      Content: DATA BECKER - Meine Homepage 3 v1.00w
    • Name: author
      Content: Patrick Sauerland

    Server / Hosting

    • IP: 217.160.231.222
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns15.schlund.de
    • ns16.schlund.de
    • mx00.schlund.de
    • mx01.schlund.de

    Target

    • hostmaster.schlund.de

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Content-Length: 7542 Date: Sun, 31 Jul 2016 10:01:34 GMT Server: Apache Last-Modified: Wed, 04 Jan 2012 08:44:39 GMT ETag: "1d76-4b5afd3899f31" Accept-Ranges: bytes X-Cache: MISS from s_hp65 X-Cache-Lookup: MISS from s_hp65:80 Via: 1.1 s_hp65 (squid/3.5.19) Connection: keep-alive

    DNS

    host: patricksauerland.de
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 217.160.231.222
    host: patricksauerland.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns15.schlund.de
    host: patricksauerland.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns16.schlund.de
    host: patricksauerland.de
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns15.schlund.de
    5. rname: hostmaster.schlund.de
    6. serial: 2016042000
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 1800
    host: patricksauerland.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.schlund.de
    host: patricksauerland.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.schlund.de

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.atricksauerland.de, www.piatricksauerland.de, www.iatricksauerland.de, www.pkatricksauerland.de, www.katricksauerland.de, www.puatricksauerland.de, www.uatricksauerland.de, www.pjatricksauerland.de, www.jatricksauerland.de, www.platricksauerland.de, www.latricksauerland.de, www.ptricksauerland.de, www.paotricksauerland.de, www.potricksauerland.de, www.paptricksauerland.de, www.pptricksauerland.de, www.pa9tricksauerland.de, www.p9tricksauerland.de, www.patricksauerland.de, www.ptricksauerland.de, www.paitricksauerland.de, www.pitricksauerland.de, www.pautricksauerland.de, www.putricksauerland.de, www.paricksauerland.de, www.patqricksauerland.de, www.paqricksauerland.de, www.pataricksauerland.de, www.paaricksauerland.de, www.pat ricksauerland.de, www.pa ricksauerland.de, www.patwricksauerland.de, www.pawricksauerland.de, www.patericksauerland.de, www.paericksauerland.de, www.patzricksauerland.de, www.pazricksauerland.de, www.patxricksauerland.de, www.paxricksauerland.de, www.patcricksauerland.de, www.pacricksauerland.de, www.paticksauerland.de, www.patriicksauerland.de, www.patiicksauerland.de, www.patroicksauerland.de, www.patoicksauerland.de, www.patrlicksauerland.de, www.patlicksauerland.de, www.patrlicksauerland.de, www.patlicksauerland.de, www.patr.icksauerland.de, www.pat.icksauerland.de, www.patrcksauerland.de, www.patrircksauerland.de, www.patrrcksauerland.de, www.patrifcksauerland.de, www.patrfcksauerland.de, www.patrivcksauerland.de, www.patrvcksauerland.de, www.patrikcksauerland.de, www.patrkcksauerland.de, www.patri,cksauerland.de, www.patr,cksauerland.de, www.patribcksauerland.de, www.patrbcksauerland.de, www.patrigcksauerland.de, www.patrgcksauerland.de, www.patritcksauerland.de, www.patrtcksauerland.de, www.patriycksauerland.de, www.patrycksauerland.de, www.patriucksauerland.de, www.patrucksauerland.de, www.patrijcksauerland.de, www.patrjcksauerland.de, www.patrimcksauerland.de, www.patrmcksauerland.de, www.patrincksauerland.de, www.patrncksauerland.de, www.patriksauerland.de, www.patricdksauerland.de, www.patridksauerland.de, www.patricrksauerland.de, www.patrirksauerland.de, www.patrictksauerland.de, www.patritksauerland.de, www.patricvksauerland.de, www.patrivksauerland.de, www.patricfksauerland.de, www.patrifksauerland.de, www.patricgksauerland.de, www.patrigksauerland.de, www.patrichksauerland.de, www.patrihksauerland.de, www.patricnksauerland.de, www.patrinksauerland.de, www.patricmksauerland.de, www.patrimksauerland.de, www.patricjksauerland.de, www.patrijksauerland.de, www.patricsauerland.de, www.patricktsauerland.de, www.patrictsauerland.de, www.patricksauerland.de, www.patricsauerland.de, www.patrickgsauerland.de, www.patricgsauerland.de, www.patrickbsauerland.de, www.patricbsauerland.de, www.patricknsauerland.de, www.patricnsauerland.de, www.patrickhsauerland.de, www.patrichsauerland.de, www.patrickysauerland.de, www.patricysauerland.de, www.patricklsauerland.de, www.patriclsauerland.de, www.patrickosauerland.de, www.patricosauerland.de, www.patrickusauerland.de, www.patricusauerland.de, www.patrickisauerland.de, www.patricisauerland.de, www.patrickmsauerland.de, www.patricmsauerland.de, www.patrickauerland.de, www.patrickseauerland.de, www.patrickeauerland.de, www.patrickswauerland.de, www.patrickwauerland.de, www.patricksdauerland.de, www.patrickdauerland.de, www.patricksxauerland.de, www.patrickxauerland.de, www.patricksfauerland.de, www.patrickfauerland.de, www.patricksgauerland.de, www.patrickgauerland.de, www.patrickstauerland.de, www.patricktauerland.de, www.patricksuerland.de, www.patricksaouerland.de, www.patricksouerland.de, www.patricksapuerland.de, www.patrickspuerland.de, www.patricksa9uerland.de, www.patricks9uerland.de, www.patricksauerland.de, www.patricksuerland.de, www.patricksaiuerland.de, www.patricksiuerland.de, www.patricksauuerland.de, www.patricksuuerland.de, www.patricksaerland.de, www.patricksauwerland.de, www.patricksawerland.de, www.patricksaueerland.de, www.patricksaeerland.de, www.patricksauserland.de, www.patricksaserland.de, www.patricksauaerland.de, www.patricksaaerland.de,

    Other websites we recently analyzed

    1. 12345.net.cn
      Fremont (United States) - 184.105.178.89
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    2. newyorkmedicalmalpracticelawyer.net
      Dover (United States) - 192.230.92.93
      Server software:
      Technology: Html, Iframe, Incapsula, Javascript
      Number of Javascript: 1
      Number of meta tags: 4
    3. COBILIGHT Willkommen bei der COBILIGHT Vertrieb GmbH
      Sparen Sie ab sofort Stromkosten und wechseln Sie mit COBILight Vertriebs GmbH auf umweltschonende und energieeffiziente Beleuchtungssysteme!
      Germany - 5.9.101.99
      Server software: Apache
      Technology: CSS, Google Font API, Html, Javascript, Php, Google +1 Button
      Number of Javascript: 6
      Number of meta tags: 13
    4. tatutaao.com
      Beijing (China) - 117.79.148.162
      Server software: Apache/2
      Technology: Html
    5. dawsonvilledoctor.com
      New York (United States) - 69.172.201.153
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    6. Guda
      Slovenia - 91.240.216.11
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 4
    7. www.885509.net
      Kowloon (Hong Kong) - 123.1.156.80
      Server software: nginx/1.0.15
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    8. Peering Exchange Hub India | Internet Exchange Point | Mumbai CH
      Mumbai CH is India's largest peering hub, offering neutral internet and peering exchange services through various traffic exchange points. Contact Us Now!
      Mumbai (India) - 206.183.111.214
      G Analytics ID: UA-79664070-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, Php, Google Analytics, Facebook Box, Google +1 Button
      Number of Javascript: 4
      Number of meta tags: 3
    9. Lanisky Data Center
      Scottsdale (United States) - 107.180.41.43
      Server software: Apache/2.4.18
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    10. Stassek Home Pferdepflege Lederpflege Hundepflege Waschmittel Haushalt Freizeit Glanzspray Pflege Reitsport Reiter Reiterin Stall Kosmetik Fellglanz www.stassek.com
      Equistar und viele weitere Produkte für Pferdepflege, Lederpflege, Hundepflege, Haushalt und Freizeit - Weltmaßstäbe in Pflegeprodukten seit 1981. Ahaus
      Germany - 217.160.223.176
      Server software: Apache
      Technology: CSS, Php
      Number of meta tags: 7

    Check Other Websites